DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss36

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:285 Identity:82/285 - (28%)
Similarity:122/285 - (42%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSFSEASLRRRAF-TSEKSETANKF----------SSRIVGGEESDVLAAPYLVSLQNAYGNHFC 71
            |.||..|....|| .|..|.|..:|          |||||||.::.....|:.|||.:. |.|.|
  Rat    21 LVFSVVSPTPGAFQDSAVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHHG-GGHIC 84

  Fly    72 AGSIIHDQWVITAASCLA--GLRK--NNVQVVTTTYNHWGS-EG-WIYSVEDIVMHCNFDSPMYH 130
            .||:|...||::||.|..  |..:  :...|:...::..|. || .:.||..|::..|:......
  Rat    85 GGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLLGVHSQDGPLEGAHMRSVATILVPDNYSRVELG 149

  Fly   131 NDIALIKTHALFDYDDVTQNITIAPLEDL-TDGETLTMYGYGSTEIGGDF--SWQLQQLDVTYVA 192
            .|:||::..:........:.:.:.....| ..|......|:|..:.....  .|.||::::..:.
  Rat   150 ADLALLRLASPAKLGPSVKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLG 214

  Fly   193 PEKCNATYGG------TPDLDVGHLCAVGKVG-AGACHGDTGGPIV-DSRGR--LVGVGNWGVPC 247
            ...|...|..      |..|..|.|||....| ...|.||:|||:| :..||  |.|:.::|..|
  Rat   215 ETACQCLYSRPGPFNLTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGC 279

  Fly   248 G-YGFPDVFARISFYYSWIISTING 271
            | ...|.||..::.|.|||...:.|
  Rat   280 GRRNRPGVFTAVAHYESWIREHVMG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 67/240 (28%)
Tryp_SPc 45..268 CDD:238113 68/242 (28%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 68/242 (28%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.