DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and KLK14

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:274 Identity:75/274 - (27%)
Similarity:124/274 - (45%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHF-CAGS 74
            :.|:|.||.....::      ::..|..||    |:||......:.|:..:|.......| |.|:
Human     1 MFLLLTALQVLAIAM------TQSQEDENK----IIGGHTCTRSSQPWQAALLAGPRRRFLCGGA 55

  Fly    75 IIHDQWVITAASC-----LAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIA 134
            ::..|||||||.|     ...|.|:|::       .|.:...:..|...|.|.|::|..:.||:.
Human    56 LLSGQWVITAAHCGRPILQVALGKHNLR-------RWEATQQVLRVVRQVTHPNYNSRTHDNDLM 113

  Fly   135 LIKTHALFDYDDVTQNITIAPLE----DLTDGETLTMYGYG--STEIGGDFSWQLQQLDVTYVAP 193
            |::..     ........:.|:|    ..:.|.:..:.|:|  |:.| ..:...||.:::.....
Human   114 LLQLQ-----QPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPI-ARYPASLQCVNINISPD 172

  Fly   194 EKCNATYGGTPDLDVGHLCA-VGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVP-CGY-GFPDVF 255
            |.|...|..|  :..|.:|| |.:.|..:|.||:|||:| .||:|.|:.:||:. |.. |:|.|:
Human   173 EVCQKAYPRT--ITPGMVCAGVPQGGKDSCQGDSGGPLV-CRGQLQGLVSWGMERCALPGYPGVY 234

  Fly   256 ARISFYYSWIISTI 269
            ..:..|.|||..|:
Human   235 TNLCKYRSWIEETM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/235 (28%)
Tryp_SPc 45..268 CDD:238113 67/237 (28%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 67/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.