DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and intr

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:247 Identity:55/247 - (22%)
Similarity:84/247 - (34%) Gaps:76/247 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNH-FCAGSIIHDQWVITAASCLAGLRKN 94
            |:|..:....|..||:                   |.|. .|:|::|..:.|:|:|.|.....: 
  Fly    91 TTEAPKAVKHFVMRIL-------------------YENKVICSGALISTRLVLTSALCFPRTLR- 135

  Fly    95 NVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLED- 158
              |....:|....|...||||.:::...       ..|:||:..|              ||||| 
  Fly   136 --QPPPRSYKLQASRSRIYSVANLITGA-------IEDMALLLLH--------------APLEDP 177

  Fly   159 -----------LTDGETLTMYGYGSTEIGGDFSWQ-LQQLDVTYVAPEKCNATYGGTPDLDVGH- 210
                       |...:.:|||          .|.| |:.|....:....|..:|....:..:.. 
  Fly   178 FVHPIDLCESPLRRNDNVTMY----------MSQQHLRFLRTKLIPNSNCKRSYAQDENAFITQT 232

  Fly   211 -LCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYG------FPDVF 255
             |||:.......|. ...|.::..:.||.||..:|..|..|      :.|||
  Fly   233 MLCALNSNRLVDCQ-TAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 52/234 (22%)
Tryp_SPc 45..268 CDD:238113 51/233 (22%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 48/207 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.