DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG5255

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:264 Identity:101/264 - (38%)
Similarity:146/264 - (55%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALSFSEASLRRRAFTSEKSE--------TANKFSSRIVGGEESDVLAAPYLVSLQN-AY 66
            ::|:||.|..         |||..:.        |.|    |||||||:....|||.:|||. ..
  Fly     1 MLLILLPLVL---------FTSSAASQILYPPQYTKN----RIVGGEEAAAGLAPYQISLQGIGS 52

  Fly    67 GNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHN 131
            |.|.|.|:||.::|:||||.|..|.:....:|:|.|.:...:....|..:.||.|.|:....|.|
  Fly    53 GAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRN 117

  Fly   132 DIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKC 196
            ||||:..:....:|:.||.:.: ..|.|..|..|.:.|:|:..:|||...:||.|:|.||..|:|
  Fly   118 DIALLHLNESIVFDNATQPVEL-DHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQC 181

  Fly   197 NATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGFPDVFARISFY 261
            .|.:..:..:|:||:|.....|.||||||:|||:|.: |:||.:.|||:||..|:||..|.||:|
  Fly   182 RAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHN-GKLVALVNWGLPCAKGYPDAHASISYY 245

  Fly   262 YSWI 265
            :.:|
  Fly   246 HDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 91/221 (41%)
Tryp_SPc 45..268 CDD:238113 91/222 (41%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 91/221 (41%)
Tryp_SPc 30..252 CDD:238113 91/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.