DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG17475

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:273 Identity:102/273 - (37%)
Similarity:149/273 - (54%) Gaps:11/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GAVSTLVLVLLALSFSEASLRRRAFTSE-------KSETANKFSSRIVGGEESDVLAAPYLVSLQ 63
            |.|..||::|....:...|..|.|..||       |:|..| |.:|::.||:..:..|.|.:|||
  Fly     5 GVVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVN-FQNRVINGEDVQLGEAKYQISLQ 68

  Fly    64 NAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPM 128
            ..||.|.|.|.||.::.|:|||.|:.|.....::|:|.|..:...:. :|.||:..:|||::||.
  Fly    69 GMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDA-VYFVEEHWIHCNYNSPD 132

  Fly   129 YHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAP 193
            ||||||||:.:....:::.||...: |...:.:|..|.:.|:||||:.||....||:..:|:|..
  Fly   133 YHNDIALIRLNDTIKFNEYTQPAEL-PTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVY 196

  Fly   194 EKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGFPDVFARI 258
            ..|.......|.....|:|.:...|.||||||:|||:..: |.|.|:.|||.||..|.||..|.:
  Fly   197 STCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHN-GVLYGLVNWGYPCALGVPDSHANV 260

  Fly   259 SFYYSWIISTING 271
            .:|..||.|.|:|
  Fly   261 YYYLEWIRSMISG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 83/220 (38%)
Tryp_SPc 45..268 CDD:238113 84/222 (38%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 83/220 (38%)
Tryp_SPc 50..269 CDD:238113 84/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.