DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG17477

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:235 Identity:90/235 - (38%)
Similarity:132/235 - (56%) Gaps:9/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSE 109
            ||||:.:....|||.||||...|:|.|.|:||.|:|:|||..|:.|...:.:||.|.|. .:...
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTI-RYAEP 90

  Fly   110 GWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGET-LTMYGYGST 173
            |.:|..:.|.:|||:|||.|.|||.|:..:....::.:||.:.: |......|.: |...|:||.
  Fly    91 GAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVEL-PTSPFPRGASELVFTGWGSQ 154

  Fly   174 EIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVG--HLCAVGKVGAGACHGDTGGPIVDSRGR 236
            ...|....|||::...::....|.:......||::|  |:||..:...||||||:|||:| .:|.
  Fly   155 SAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLV-HQGT 218

  Fly   237 LVGVGNWGVPCGYGFPDVFARISFYYSWIISTING---CA 273
            |||:.|:.|||..|.||:|..|.:|..|:..|::|   ||
  Fly   219 LVGILNFFVPCAQGVPDIFMNIMYYRDWMRQTMSGNGKCA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 85/222 (38%)
Tryp_SPc 45..268 CDD:238113 86/225 (38%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 86/225 (38%)
Tryp_SPc 27..246 CDD:214473 85/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.