DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG10405

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:272 Identity:78/272 - (28%)
Similarity:122/272 - (44%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSII 76
            :||:|..|.:||::.|:.            .||||.|.|:.....||.:||:. ...|.|..||:
  Fly    16 ILVILEASRTEAAVPRQP------------DSRIVNGREATEGQFPYQLSLRR-QTVHICGASIL 67

  Fly    77 HDQWVITAASCLAG---------LRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHND 132
            ...|.||||.|:.|         ||:.::...        |.|.:..|:.|..|..:|....:.|
  Fly    68 SSNWAITAAHCIDGHEQQPREFTLRQGSIMRT--------SGGTVQPVKAIYKHPAYDRADMNFD 124

  Fly   133 IALIKTHALFDYDDVTQNI---TIAPLEDLTDGETLT------MYGYGSTEIGGD-FSWQLQQLD 187
            :||::|      .|...::   .:||:...|.||.::      :.|:|....... .|..|:...
  Fly   125 VALLRT------ADGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTT 183

  Fly   188 VTYVAPEKCN---ATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCG- 248
            |..|..|||:   ..:||..:   ...||..: ...||.||:|||| .::|.|:|:.:|||.|. 
  Fly   184 VLTVNQEKCHNDLRHHGGVTE---AMFCAAAR-NTDACQGDSGGPI-SAQGTLIGIVSWGVGCAD 243

  Fly   249 -YGFPDVFARIS 259
             | :|.|:.|::
  Fly   244 PY-YPGVYTRLA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 70/240 (29%)
Tryp_SPc 45..268 CDD:238113 69/239 (29%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 70/240 (29%)
Tryp_SPc 37..263 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.