DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG16749

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:239 Identity:80/239 - (33%)
Similarity:130/239 - (54%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKN--NVQVVTTTYNHW 106
            |:|.|.:|.|...|:::|::.:.|:|.|.||||..|:|:|||.|..|.:.:  :||...|..|..
  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93

  Fly   107 GSEGWIYSVEDIVMHCNFDSPM--YHNDIALIKTHALFDYDDVTQNITIAP--LEDL------TD 161
            |..  :..|:.|:.|.:: :|.  |.|||:|:.....|::|    .:|:||  |.:|      ||
  Fly    94 GPN--VVRVKKIIQHEDY-NPYNNYANDISLLLVEEPFEFD----GVTVAPVKLPELAFATPQTD 151

  Fly   162 --GETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLC-AVGKVGAGACH 223
              ||.: :.|:|....||.....||::::...:.|:|...:||..|... |:| .|.:.|.|.|.
  Fly   152 AGGEGV-LIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRY-HICGGVDEGGKGQCS 214

  Fly   224 GDTGGPIVDSRGRLVGVGNWGV-PCGYG-FPDVFARISFYYSWI 265
            ||:|||:: ..|:.||:.:|.: ||... :|.|:.::|.|..||
  Fly   215 GDSGGPLI-YNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 78/237 (33%)
Tryp_SPc 45..268 CDD:238113 79/238 (33%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 78/237 (33%)
Tryp_SPc 30..259 CDD:238113 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.