DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and C1rl

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001002804.2 Gene:C1rl / 408246 RGDID:1302936 Length:488 Species:Rattus norvegicus


Alignment Length:269 Identity:75/269 - (27%)
Similarity:115/269 - (42%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SETANKF-SSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCL-----AGLRK 93
            :|..|.| |||...|.      .|: .:..:.||..  .|:::.|:|::|||..:     ..|||
  Rat   236 AENPNTFGSSRAKPGN------FPW-QAFTSIYGRG--GGALLGDRWILTAAHTIFPKDSIYLRK 291

  Fly    94 NNVQVVTTTYNHWGSEGWI----YSVEDIVMHCNFDSPMYHN---DIALIKTHALFDYDDVTQNI 151
            |  :.|.....|...:..:    :.|..:|:|.::.....||   ||||:         ::...:
  Rat   292 N--KTVNVFLGHTDVDELLKLGNHPVRRVVVHPDYRQEESHNFDGDIALL---------ELEHRV 345

  Fly   152 TIAPL---EDLTDGETL---TMYGYGSTEIGGDFSWQLQQLDVTY--VAP-EKCNATYGGTPDLD 207
            .:.|.   ..|.|.|||   .::||.| ..|.:..|...:|..:.  ||| |.|.|........:
  Rat   346 PLGPSLLPVCLPDNETLYHSGLWGYIS-GFGVEMGWLTTKLKYSKLPVAPREACEAWLRQRQRTE 409

  Fly   208 V--GHLCAVG---KVGAGACHGDTGGPIV--DSRG-RLV--GVGNWGVPC--GYGFPDVFARISF 260
            |  .::..||   :|.: .|.||:|...|  |.|. |.|  |:.:|||.|  ||||   :.::..
  Rat   410 VFSDNMFCVGEEMQVNS-VCQGDSGSVYVVWDDRALRWVATGIVSWGVGCGKGYGF---YTKVLS 470

  Fly   261 YYSWIISTI 269
            |..||...|
  Rat   471 YVDWIKGVI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 67/253 (26%)
Tryp_SPc 45..268 CDD:238113 68/255 (27%)
C1rlNP_001002804.2 CUB 55..164 CDD:238001
Tryp_SPc 243..476 CDD:238113 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.