DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Klk4

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:253 Identity:72/253 - (28%)
Similarity:120/253 - (47%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TANKFSSRIVGGEESDVLAAPY---LVSLQNAYGNHFCAGSIIHDQWVITAASCL-----AGLRK 93
            :|:..||||:.|::....:.|:   |.|..||:   ||:|.::|.|||::||.|:     .||..
  Rat    24 SASSISSRIIQGQDCLPHSQPWQAALFSEDNAF---FCSGVLVHPQWVLSAAHCIQDSYTVGLGL 85

  Fly    94 NNVQVVTTTYNHWGSE---GWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAP 155
            :|::         ||:   ..:......:.|.|::.|.:.||:.|||.:......:..:.|.:|.
  Rat    86 HNLE---------GSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVAS 141

  Fly   156 LEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAG 220
             :..|.|:|..:.|:|..: .|.....||.::::..:.|.|...|  .|...:...||    |.|
  Rat   142 -QCPTPGDTCLVSGWGRLK-NGKLPSLLQCVNLSVASEETCRLLY--DPVYHLSMFCA----GGG 198

  Fly   221 -----ACHGDTGGPIVDSRGR----LVGVGNWGVPCGYGFPDVFARISFYYSWIISTI 269
                 .|:||:|||||.:|..    .:|.|..|.|   |.|.|:..:..:.:||.:||
  Rat   199 PDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQP---GIPSVYTNLCKFTNWIWTTI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/240 (27%)
Tryp_SPc 45..268 CDD:238113 66/242 (27%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 63/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.