DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG11037

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:235 Identity:59/235 - (25%)
Similarity:107/235 - (45%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SRIVGGE-ESDVLAAPYLVSLQNAYGNHF-CAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNH 105
            :|::||. .::.....||.:|  .|.:.| |.|:::::..|:|||.|..|..|.:..:|....::
  Fly    60 TRVIGGHVTTNAKLGGYLTAL--LYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWIVAAGISN 122

  Fly   106 WGSEGWIYSVEDIVMHCNFDSPMYHNDIA--LIKTHALFDYDDVTQNITIAPL--EDLTDGETLT 166
            ...:|....|:|.::...|.....:.|:|  |:||..      ..:||....|  ..|..|..|.
  Fly   123 LNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPL------KAKNIGTLSLCSVSLKPGVELV 181

  Fly   167 MYGYGSTEIGGDFSWQ-LQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPI 230
            :.|:|.|...|..... |:.:.|..:..:.|.|.|..|..:....:||.......||..|:|||:
  Fly   182 VSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACTFDSGGPL 246

  Fly   231 VDSRGRLVGVGNWGVPCGYG-FPDVFARISFYYSWIISTI 269
            |..: ::.|:.::|:.|... :|.|:..:.:...:|..:|
  Fly   247 VFKK-QVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 57/228 (25%)
Tryp_SPc 45..268 CDD:238113 57/230 (25%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 57/228 (25%)
Tryp_SPc 62..283 CDD:238113 57/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.