DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG10663

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:272 Identity:62/272 - (22%)
Similarity:110/272 - (40%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KSETANKFSS---RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNN 95
            :|.|..:..|   :|:||..:.....|:.|::.|.:...||.|::|..:||:|||.|:..:....
  Fly   493 RSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVR 557

  Fly    96 VQVVTTTYNHWGSEGWIYSVEDIVM----HCNFDSPMYHNDIALIK------THALFDYDDVTQN 150
            :......|.. |:|     ::..||    |.|||.....:|:||::      ......|..:.| 
  Fly   558 IGEHNLNYED-GTE-----IQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQ- 615

  Fly   151 ITIAPLEDLTDGETLTMYGYG--------STEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLD 207
                |.:.|......|:.|:|        .|.:       |.:..|..:..:.|...|   .|..
  Fly   616 ----PFQALPKNVDCTIIGWGKRRNRDATGTSV-------LHKATVPIIPMQNCRKVY---YDYT 666

  Fly   208 V--GHLCAVGKVG-AGACHGDTGGPIV-------DSRGRLVGVGNWGVPCG----YGFPDVFARI 258
            :  ...||..:.| ...|.||:|||::       :....:.|:.::|..|.    :|   ::|::
  Fly   667 ITKNMFCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFG---IYAKV 728

  Fly   259 SFYYSWIISTIN 270
            ..|..|:.|.:|
  Fly   729 PNYVDWVWSVVN 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 56/252 (22%)
Tryp_SPc 45..268 CDD:238113 57/254 (22%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 56/252 (22%)
Tryp_SPc 507..735 CDD:238113 56/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.