DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG32374

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:97/233 - (41%) Gaps:8/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSII-HDQWVITAASCLAGLRKNNVQVV 99
            |..:...:|||.|::.....|||..:|.  |.|:|..|.:| :.:|::||..|..|.........
  Fly    65 EAQDYLPTRIVNGKKIKCSRAPYQCALH--YNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRA 127

  Fly   100 TTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGET 164
            .:|....|  |.:..|:..|.|.|:......||:.::|.....:.....|.:.:.........:.
  Fly   128 GSTQQRRG--GQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTRTKRFPKC 190

  Fly   165 LTMYGYGSTEIGG-DFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGG 228
            ....|:|.|.... :....|:.:.|..|:..||...|.||.......:....:.....|.||:||
  Fly   191 YLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTCSGDSGG 255

  Fly   229 PIVDSRGRLVGVGNWGVPCGYG-FPDVFARISFYYSWI 265
            |:|.: |.|.|:.::|:.|... :|.|:..:..|..||
  Fly   256 PLVHN-GVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 55/223 (25%)
Tryp_SPc 45..268 CDD:238113 56/224 (25%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 55/223 (25%)
Tryp_SPc 74..295 CDD:238113 56/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.