DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG16998

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:125/270 - (46%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VSTLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCA 72
            ::.|.|:||.:...:.|    |.:.::         |||||.|..:...|:|.|: ..:||:.|:
  Fly     1 MNILALILLLICGHKTS----ALSPQE---------RIVGGVEVPIHLTPWLASI-TVHGNYSCS 51

  Fly    73 GSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIK 137
            .::|...|::||..|:......:|:..:|..:..|..   .:|..:::|.:|:.....|||||:|
  Fly    52 SALITSLWLVTAGHCVQYPDSYSVRAGSTFTDGGGQR---RNVVSVILHPDFNLRTLENDIALLK 113

  Fly   138 THALFDYDDVTQNITIAPLEDLTD-GETLTMYGYGSTE-IGGDFSWQLQQLDVTYVAPEKCNATY 200
            ....|......|.:.: ||..|.. ..||.:.|:|:.: ...:...:|:...|..:....|...|
  Fly   114 LDKSFTLGGNIQVVKL-PLPSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLY 177

  Fly   201 GG-----TPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCG-YGFPDVFARIS 259
            ..     |.|:    :||.| .|...|:||:|.|:| .||...|:.::...|. ..||.|:.|::
  Fly   178 SHLHRPITDDM----VCAAG-AGRDHCYGDSGAPLV-HRGSSYGIVSFAHGCADPHFPGVYTRLA 236

  Fly   260 FYYSWIISTI 269
            .|.:||.:.:
  Fly   237 NYVTWIFNVL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 63/228 (28%)
Tryp_SPc 45..268 CDD:238113 64/230 (28%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 63/228 (28%)
Tryp_SPc 25..242 CDD:238113 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.