DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG32277

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:245 Identity:72/245 - (29%)
Similarity:112/245 - (45%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGS 108
            :|.||:.:.|....:||:|:.. |...|.|.||....|:|||.||                    
  Fly    26 KIFGGKTTLVKDHSFLVNLRRG-GKFRCGGVIISPNCVLTAAHCL-------------------- 69

  Fly   109 EGWIYSVEDIVMH----CNFD---------------SPMY------HNDIALIKTHALFDYDDVT 148
            ||....|.|:.:|    |..|               ||.|      .:|:|:|:....|   |:.
  Fly    70 EGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPF---DIA 131

  Fly   149 QNITIAPLE--DLTDGETLTMYGYGS-TEIGGDFSWQLQQLDVTYVAPEKCNATYG-GTPDLDVG 209
            .|.::..::  ||.....||:.|:|: .|.|.:::..||:.:|..::..:|..:.| |...:...
  Fly   132 GNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNN 196

  Fly   210 HLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGFPDVFARIS 259
            ..||:||....||.||:|||.:.: ||.||:.:||..||.|:|.|:.|:|
  Fly   197 MFCALGKNARDACQGDSGGPAIYA-GRSVGIVSWGYGCGSGYPGVYTRLS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 72/245 (29%)
Tryp_SPc 45..268 CDD:238113 72/244 (30%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 72/245 (29%)
Tryp_SPc 27..246 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.