DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and KLKB1

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:268 Identity:84/268 - (31%)
Similarity:126/268 - (47%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TSEKSETANKFSSRIVGGEESDVLAAPYLVSLQ--NAYGNHFCAGSIIHDQWVITAASCLAGLRK 93
            |.:.|....|.|:|||||..|.....|:.||||  .....|.|.||:|..|||:|||.|..||..
Human   388 TGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPL 452

  Fly    94 NNVQVVTTTYNHWGSEGW-IYS----------------VEDIVMHCNFDSPMYHNDIALIKTHAL 141
            .:|              | |||                :::|::|.|:.....::||||||..|.
Human   453 QDV--------------WRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAP 503

  Fly   142 FDYDDVTQNITIAPLEDLTDGETLTMY------GYGSTEIGGDFSWQLQQLDVTYVAPEKCNATY 200
            .:|.:..:.|.:.     :.|:|.|:|      |:|.::..|:....||::::..|..|:|...|
Human   504 LNYTEFQKPICLP-----SKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRY 563

  Fly   201 GGTPDLDVGH--LCAVGKVGA-GACHGDTGGPIV---DSRGRLVGVGNWGVPCG-YGFPDVFARI 258
               .|..:..  :||..|.|. .||.||:|||:|   :...||||:.:||..|. ...|.|:.::
Human   564 ---QDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKV 625

  Fly   259 SFYYSWII 266
            :.|..||:
Human   626 AEYMDWIL 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 78/252 (31%)
Tryp_SPc 45..268 CDD:238113 79/254 (31%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 401..632 CDD:214473 78/252 (31%)
Tryp_SPc 402..632 CDD:238113 77/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.