DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG32833

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:286 Identity:69/286 - (24%)
Similarity:116/286 - (40%) Gaps:61/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSL---QNAYGNHFCA 72
            :.|.|..||.|:..    |....:.:..|..:...:||...::..||::.|:   |.|.    |.
  Fly     8 IFLALFVLSKSDTG----AGEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKAK----CD 64

  Fly    73 GSIIHDQWVITAASCLAGLRKN--NVQVVTTTYNHWGSEGWI-YSVEDIVMHCNFDSPMYHNDIA 134
            |:|.....::||..|:.|....  .|:|.:||    .|:|.| .:|.:|.:|..|......:::|
  Fly    65 GAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTT----RSDGVIEVAVCNITVHEKFTGQTVFHNVA 125

  Fly   135 LIKTHALFDYDDVTQNITIA---PLEDLTDGETLTMYGYGSTEIGGDFSW--------------Q 182
            ::|.....:.....|.|.:|   |    ::|..:|..|:.|      |.|              :
  Fly   126 ILKLCEPLEASKTIQPIQLANQLP----SNGAKVTANGWPS------FRWWAMYWKKCLDDEAYK 180

  Fly   183 LQQLDVTYVAPEKCNATYGG--------TPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVG 239
            ||:.:|..:.|.:|...:..        |.||    .| ..|....||....|.|:|.: |:|||
  Fly   181 LQKAEVKLLGPSQCTDLWARNNWSKKNFTDDL----FC-TEKFAKEACSLAMGSPVVHN-GKLVG 239

  Fly   240 VGNWGVPCGYGFPDVFARISFYYSWI 265
            :...| .|. .:|:|:..:..|..|:
  Fly   240 IITKG-GCS-EYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 61/251 (24%)
Tryp_SPc 45..268 CDD:238113 62/252 (25%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 62/250 (25%)
Tryp_SPc 40..262 CDD:214473 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.