DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and iotaTry

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:130/270 - (48%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GAVSTLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHF 70
            |.|:| |||||.|             .:.|:.  :.:.||:||.:..:..||:.||:|.: ..|.
  Fly     5 GIVAT-VLVLLLL-------------GDASDV--EATGRIIGGSDQLIRNAPWQVSIQIS-ARHE 52

  Fly    71 CAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNH-WGSEGWIYSVEDIVMHCNFDSPMYHNDIA 134
            |.|.|...:.:|||..||.......::|.....|| :|  |.:..|....:|..|||...|.|||
  Fly    53 CGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYG--GTLVPVAAYKVHEQFDSRFLHYDIA 115

  Fly   135 LIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKC-NA 198
            :::......:...|:.|.:|.... :.|.|:|:.|:|.|: .|..|..||:..:..:...:| :.
  Fly   116 VLRLSTPLTFGLSTRAINLASTSP-SGGTTVTVTGWGHTD-NGALSDSLQKAQLQIIDRGECASQ 178

  Fly   199 TYGGTPDLDVGH--LCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCG-YGFPDVFARISF 260
            .:|...|. ||.  :|| ....|.||.||:|||:|.| .:|||:.:||..|. ..:|.|:|.::.
  Fly   179 KFGYGADF-VGEETICA-ASTDADACTGDSGGPLVAS-SQLVGIVSWGYRCADDNYPGVYADVAI 240

  Fly   261 YYSWIISTIN 270
            ...||:...|
  Fly   241 LRPWIVKAAN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 71/225 (32%)
Tryp_SPc 45..268 CDD:238113 72/227 (32%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 71/225 (32%)
Tryp_SPc 28..247 CDD:238113 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.