DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Send2

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:117/265 - (44%) Gaps:48/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLLAL-SFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSII 76
            |:|||| |.|...:.|.             ..||:||:...:..||:.||:|.. |.|.|.|||.
  Fly     7 LLLLALNSLSAGPVIRP-------------EERIIGGQPIGIEEAPWQVSIQRD-GKHLCGGSIY 57

  Fly    77 HDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHAL 141
            ....:||||.|:.| :...|:..:...|   |.|.:..|..|..|....     ||||:::....
  Fly    58 SADIIITAAHCVQG-QGYQVRAGSALKN---SNGSVVDVAAIRTHEGLG-----NDIAIVRLSKP 113

  Fly   142 FDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDV----TYVA-PEKCNATYG 201
            .::.:..|.|.:|.... ..|....:.|:||:      |:....:|:    .|:. |..|..|  
  Fly   114 LEFTNQVQPIPLAKTNP-PPGSIAFVSGWGSS------SYYSHPIDLQGVNLYIQWPYYCGLT-- 169

  Fly   202 GTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGV-PCGYGFPDVFARISFYYSWI 265
                 :...:|| |..|..||.||:|||:|..: :||||.:.|. .|.|.  .::..:.::..||
  Fly   170 -----EPSRICA-GSFGRAACKGDSGGPLVFDQ-QLVGVVSGGTKDCTYS--SIYTSVPYFREWI 225

  Fly   266 ISTIN 270
            ::.|:
  Fly   226 LNAID 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 64/226 (28%)
Tryp_SPc 45..268 CDD:238113 65/228 (29%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 64/226 (28%)
Tryp_SPc 27..225 CDD:238113 63/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.