DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Phae2

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:273 Identity:78/273 - (28%)
Similarity:129/273 - (47%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIH 77
            ::|||:..|:.|    ....::.|      .|:|||:.:...:|||:||:|.. |.|:||.:||:
  Fly    10 ILLLAVCVSQGS----GLALDQPE------GRVVGGKAAAANSAPYIVSMQYG-GTHYCAANIIN 63

  Fly    78 DQWVITAASCLAG--------LRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIA 134
            ..|::|||.|||.        |...::.|..|.......:...|.:.|:     :.......||.
  Fly    64 SNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDL-----YTGGTVPYDIG 123

  Fly   135 LIKTHALFDYDDVTQNITIAPLEDLTDGETLT----MYGYGSTEIGGDFSW--QLQQL-DVTYVA 192
            ||.|...|     |....:||::..:.|...|    ::|:|||......|:  .||:. ::..::
  Fly   124 LIYTPTAF-----TWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIIS 183

  Fly   193 PEKCNATYGGT-PDLDVGHLCAVGKV--GAGACHGDTGGPIVDSRGRLVGVGNWG-VPCGY-GFP 252
            .:.|.|..|.. .|:...:|| .|.:  |...|..|:|||:|.. ..|:|:.:|| :|||. ..|
  Fly   184 LDSCAAALGSKGQDVHTTNLC-TGPLTGGTSFCTSDSGGPLVQG-NVLIGIVSWGKLPCGQPNSP 246

  Fly   253 DVFARISFYYSWI 265
            .|:.::|.:.:||
  Fly   247 SVYVQVSSFITWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 70/240 (29%)
Tryp_SPc 45..268 CDD:238113 71/241 (29%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 70/240 (29%)
Tryp_SPc 32..262 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.