DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CFI

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001362207.1 Gene:CFI / 3426 HGNCID:5394 Length:601 Species:Homo sapiens


Alignment Length:193 Identity:49/193 - (25%)
Similarity:88/193 - (45%) Gaps:29/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGS 108
            |||||:.:.:...|:.|::::|.| ..|.|..|...|::|||.||...:.:..|:.||..:    
Human   347 RIVGGKRAQLGDLPWQVAIKDASG-ITCGGIYIGGCWILTAAHCLRASKTHRYQIWTTVVD---- 406

  Fly   109 EGWIYS---------VEDIVMHCNFDSPMYHNDIALIKTHALFDYDD------VTQNITIAPLED 158
              ||:.         |:.|:.|.|:::..|.||||||:.....:..|      :...:..:|.. 
Human   407 --WIHPDLKRIVIEYVDRIIFHENYNAGTYQNDIALIEMKKDGNKKDCELPRSIPACVPWSPYL- 468

  Fly   159 LTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGG---TPDLDVGHLCAVGKVG 218
            ....:|..:.|:| .|...:..:.||..:|..::  .|:..||.   ..:::....|:|.:.|
Human   469 FQPNDTCIVSGWG-REKDNERVFSLQWGEVKLIS--NCSKFYGNRFYEKEMECADCCSVAQAG 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 49/193 (25%)
Tryp_SPc 45..268 CDD:238113 48/192 (25%)
CFINP_001362207.1 FIMAC 43..108 CDD:214493
SR 114..215 CDD:214555
LDLa 224..256 CDD:238060
Ldl_recept_a 257..293 CDD:365841
Tryp_SPc 348..>519 CDD:238113 45/181 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.