DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Try29F

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:141/283 - (49%) Gaps:40/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGAVSTLV------LVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQ 63
            ||...|::      ::|:.||.. |::||           .:...|||||:.:::...||.||||
  Fly     8 TGMAKTILHLFIGGILLVNLSLG-ATVRR-----------PRLDGRIVGGQVANIKDIPYQVSLQ 60

  Fly    64 NAYGNHFCAGSIIHDQWVITAASCLAG----LRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNF 124
            .:|  |||.||:|...||:|||.|..|    |.|..:....|:..     |.:..::.:..|..|
  Fly    61 RSY--HFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGSSRTSVG-----GQLVGIKRVHRHPKF 118

  Fly   125 DSPMYHNDIALIKTHALFDYD--DVTQNITIAPLE--DLTDGETLTMYGYGSTEIGGDFSWQLQQ 185
            |:.....|.:|::   |.:|.  :|||.....|.:  |:.||..:.:.|:|:|:...:.|..|:.
  Fly   119 DAYTIDFDFSLLE---LEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRS 180

  Fly   186 LDVTYVAPEKCNATYGGTPDLDVGHLCA-VGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGY 249
            :.|..|:..:|...||....:....||| :.:.|..||.||:|||:. :.|.|.||.:||..|..
  Fly   181 VTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLA-ADGVLWGVVSWGYGCAR 244

  Fly   250 -GFPDVFARISFYYSWIISTING 271
             .:|.|::|:|....| ||:::|
  Fly   245 PNYPGVYSRVSAVRDW-ISSVSG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 75/230 (33%)
Tryp_SPc 45..268 CDD:238113 76/232 (33%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 76/231 (33%)
Tryp_SPc 42..264 CDD:238113 77/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.