DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and PRSS38

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:295 Identity:80/295 - (27%)
Similarity:131/295 - (44%) Gaps:49/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AVSTLVLVLLALSFSEASLRRR-------AFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQN 64
            |:..|:|:|:......|:|..|       :.|...:........:|:||..:.....|:.||:..
Human    15 ALGLLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERKWPWQVSVHY 79

  Fly    65 AYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQV-----------VTTTYNHWGSEGWIYSVEDI 118
            | |.|.|.|||:::.||::||.|..  |..|:::           |...:..|      |.|..:
Human    80 A-GLHVCGGSILNEYWVLSAAHCFH--RDKNIKIYDMYVGLVNLRVAGNHTQW------YEVNRV 135

  Fly   119 VMHCNFDSPMYH---NDIALI--KTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGD 178
            ::|..::  |||   .|:||:  ||..:|. :.|.......|..:||....... |:|.....|:
Human   136 ILHPTYE--MYHPIGGDVALVQLKTRIVFS-ESVLPVCLATPEVNLTSANCWAT-GWGLVSKQGE 196

  Fly   179 FSWQLQQLDVTYVAPEKCNATYGG----TPDLDVGHLCAVGKVGA-GACHGDTGGPIVDSRGR-- 236
            .|.:||::.:..:....|:..||.    .||:    |||...:.| ..|.||:|||:|....|  
Human   197 TSDELQEMQLPLILEPWCHLLYGHMSYIMPDM----LCAGDILNAKTVCEGDSGGPLVCEFNRSW 257

  Fly   237 -LVGVGNWGVPCGYG-FPDVFARISFYYSWIISTI 269
             .:|:.:||..|... :|.|:|.:|::..||...|
Human   258 LQIGIVSWGRGCSNPLYPGVYASVSYFSKWICDNI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 69/245 (28%)
Tryp_SPc 45..268 CDD:238113 71/247 (29%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.