DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and PRSS53

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:291 Identity:63/291 - (21%)
Similarity:102/291 - (35%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHW----GS---EGWIYS 114
            |:..|::. .|.|.|:||::.|.||:|||.|..       :...|..|.|    ||   ||....
Human    49 PWQASVRR-QGAHICSGSLVADTWVLTAAHCFE-------KAAATELNSWSVVLGSLQREGLSPG 105

  Fly   115 VEDIVMHCNFDSPMYHN------DIALIK-----THA------------------LFDYDDVTQ- 149
            .|::.: .....|..:|      |:||::     ||.                  ...:|..|. 
Human   106 AEEVGV-AALQLPRAYNHYSQGSDLALLQLAHPTTHTPLCLPQPAHRFPFGASCWATGWDQDTSD 169

  Fly   150 ----------------NITI---------APLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVT 189
                            ::|:         :||  |...:||......|...|     .|:.|.:.
Human   170 GKCWPRLKLGEALCLPSVTVSAPNCPGFQSPL--LPRSQTLAPAPSLSPAPG-----TLRNLRLR 227

  Fly   190 YVAPEKCNATYGGTPDLDV------GHLCAVGKVGA-GACHGDTGGPIV----DSRGRLVGVGNW 243
            .::...||..|.......:      |.||...:.|. |.|.||:|||::    |......|:.::
Human   228 LISRPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISF 292

  Fly   244 GVPCGY-GFPDVFARISFYYSWIISTINGCA 273
            ...|.. ..|.:....:.:.||:.:.:.|.|
Human   293 ASSCAQEDAPVLLTNTAAHSSWLQARVQGAA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 60/281 (21%)
Tryp_SPc 45..268 CDD:238113 61/284 (21%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 61/282 (22%)
Tryp_SPc 43..314 CDD:214473 59/280 (21%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.