DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG31954

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:266 Identity:82/266 - (30%)
Similarity:134/266 - (50%) Gaps:20/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLVLLALSFSEASLRRRAFTSEKSETANKFS----SRIVGGEESDVLAAPYLVSLQNAYGNHFCA 72
            :|||..:......::|:....:..:...|.|    .|||||...::..||:.||||.:  :|.|.
  Fly    14 LLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQTS--SHICG 76

  Fly    73 GSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIK 137
            ||||.::|::|||.|..|...:.::|...| :.:...|.:..|:.||.|..|:......|.:|::
  Fly    77 GSIISEEWILTAAHCTYGKTADRLKVRLGT-SEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQ 140

  Fly   138 THALFDYDDVTQNITIAPLE-DLTDGETLTMYGYGSTE-IGGDFSWQLQQLDVTYVAPEKCN--- 197
            ......:|:..:.:.:...: ...|||...:.|:|:|: :.....| |:|::|..|..|.|:   
  Fly   141 LAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREW-LRQVEVPLVNQELCSEKY 204

  Fly   198 ATYGGTPD--LDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGY-GFPDVFARIS 259
            ..|||..:  :..|.|    :.|..||.||:|||:|...|.||||.:||..|.. .:|.|::|:|
  Fly   205 KQYGGVTERMICAGFL----EGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVS 265

  Fly   260 FYYSWI 265
            |...||
  Fly   266 FARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 74/228 (32%)
Tryp_SPc 45..268 CDD:238113 75/229 (33%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 74/228 (32%)
Tryp_SPc 51..274 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.