DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG4271

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:275 Identity:68/275 - (24%)
Similarity:111/275 - (40%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 STLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAG 73
            |..||:|.|.|                      |:.|..|.|:......:|.|:. ..|.|.|.|
  Fly     5 SCWVLILFARS----------------------SNGIYNGVEAKFDFWTFLASVW-VSGYHECGG 46

  Fly    74 SIIHDQWVITAASCLAG--LRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALI 136
            ::|..:.|:|||.|:..  :::..|:|.|......|.   |..|..:|:|.|:.:  :.|||||:
  Fly    47 AVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGR---IIRVTALVVHENYKN--WDNDIALL 106

  Fly   137 KTHALFDYDDVTQNITIAPL--EDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNAT 199
                ..:...::..:|..||  ::.::.|..:..|:|            ::|..:||...|..  
  Fly   107 ----WLEKPVLSVRVTKIPLATKEPSENEYPSNAGWG------------EKLLESYVVTRKLQ-- 153

  Fly   200 YGGTPDLDVGHLCA---VGKVGA----------GACHGDTGGPIVDSRGRLVGVGNWGVPCGYG- 250
             .|...:....:||   |..||.          ..|.||.|||:| ...::||:...|..||:. 
  Fly   154 -NGVTKIRPRSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLV-LANKVVGIAVQGHGCGFAV 216

  Fly   251 FPDVFARISFYYSWI 265
            .|.::..:..|..||
  Fly   217 LPSLYTNVFHYLEWI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 59/238 (25%)
Tryp_SPc 45..268 CDD:238113 61/239 (26%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 61/239 (26%)
Tryp_SPc 19..231 CDD:214473 59/237 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.