DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Ser12

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:253 Identity:72/253 - (28%)
Similarity:118/253 - (46%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIH-DQWVITAASC-------LAGLRK 93
            :|.....|||||....:...|:..:|.  |...:..|::|: |:.:||||.|       |..:|.
  Fly    16 SAGSSPERIVGGHPVLISEVPWQAALM--YSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRV 78

  Fly    94 NNVQVVTTTYNHWGSEGWIYS-VEDIVMHCNF-DSPMYHNDIALIKTHALFDYDDVTQNITIAPL 156
            .:|         |.:.|..:: |..|..|.:: .|.:..||||:|:.     .|.:..|..:.|:
  Fly    79 GSV---------WKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRL-----VDTLIFNAEVRPI 129

  Fly   157 EDLTD-----GETLTMYGYGSTEIGGDFSW----QLQQLDVTYVAPEKCNATYGGTPDLDVGHLC 212
            : |.|     |...::.|:|  |||  ..|    .|.:..|..:.|..|..:|   ..:....:|
  Fly   130 Q-LADSAPAAGTEASVSGWG--EIG--ILWLQPTSLLKTSVKILDPNVCKRSY---QYITKTMIC 186

  Fly   213 AVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYG-FPDVFARISFYYSWIISTI 269
            |...: ..:||||:|||:| |.|:|||:.::|:.|... ||.|:|.::....||::.|
  Fly   187 AAALL-KDSCHGDSGGPLV-SGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 68/240 (28%)
Tryp_SPc 45..268 CDD:238113 69/242 (29%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 68/240 (28%)
Tryp_SPc 24..238 CDD:238113 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.