DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG1304

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:127/269 - (47%) Gaps:45/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIH 77
            |:|||:....|              ....:.|:||||::.....|:.|||:|| |:|.|.|||:.
  Fly    14 LLLLAVPVHSA--------------PGSLNGRVVGGEDAVKNQFPHQVSLRNA-GSHSCGGSILS 63

  Fly    78 DQWVITAASCLAGLRKNNVQV--------VTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIA 134
            ..:|:|||.|:.....|...|        :....|...|.|.:..|.::::|..:.:  :.||:|
  Fly    64 RNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVA 126

  Fly   135 LIKTHALFDYDDVTQNITIAPLEDLTDGET-----LTMYGYGSTEIGGDFSWQLQQLDVTYVAPE 194
            |::..:     .:..:.:|.|: ||...:|     :.:.|:|..:..||....||...:..::.|
  Fly   127 LLRLES-----PLILSASIQPI-DLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLE 185

  Fly   195 KCNATYG-GTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGN--WGVPCGYGFPDVFA 256
            :|:...| |..    ..||.:.:...|||:||:|||.| ...::|||..  |.. ||..:||.:|
  Fly   186 RCDELIGWGVQ----SELCLIHEADNGACNGDSGGPAV-YNNQVVGVAGFVWSA-CGTSYPDGYA 244

  Fly   257 RISFYYSWI 265
            |:.::..||
  Fly   245 RVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 69/236 (29%)
Tryp_SPc 45..268 CDD:238113 70/237 (30%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 69/236 (29%)
Tryp_SPc 32..256 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.