DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG9673

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:244 Identity:72/244 - (29%)
Similarity:111/244 - (45%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGN-HFCAGSIIHDQWVITAASCLAGLRKNNVQVVTT-----T 102
            ||:|||  ||....|..|....|.. |.|:|:||....::|||.|::.:....|...|.     |
  Fly    28 RILGGE--DVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLGT 90

  Fly   103 YNHWGSEGWIYSVEDIVMHCNFDSPMYHN---DIALIKTHALFDYDDVTQNITIAPLED------ 158
            .|.:.. |.|.:|:.:::|     |.|.|   |||:::......:.|..|:|.:.|..|      
  Fly    91 INQYAG-GSIVNVKSVIIH-----PSYGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDV 149

  Fly   159 ---LTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKC--NATYGGTPDLDVGHLCAVGKVG 218
               |.:|..:.:.|:|... .|..|::.|:.:...::...|  .|.||..     ..:|.....|
  Fly   150 DAELPNGTPVYVAGWGELS-DGTASYKQQKANYNTLSRSLCEWEAGYGYE-----SVVCLSRAEG 208

  Fly   219 AGACHGDTGGPIVDSRGRLVGVG--NWGVPCGYGFPDVFARISFYYSWI 265
            .|.|.||.|..::|....|.|:.  |:| |||..:|||..|:|:|.:||
  Fly   209 EGICRGDAGAAVIDDDKVLRGLTSFNFG-PCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 70/242 (29%)
Tryp_SPc 45..268 CDD:238113 71/243 (29%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/242 (29%)
Tryp_SPc 29..259 CDD:238113 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.