DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and sphe

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:240 Identity:79/240 - (32%)
Similarity:118/240 - (49%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQ--NAYGNHFCAGSIIHDQWVITAASC------LAGLRKNNVQVVT 100
            ||:|||::|..|..:..||:  ||   |.|.|||:....::|.|.|      |....:...:|.:
  Fly    25 RIMGGEDADATATTFTASLRVDNA---HVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGS 86

  Fly   101 TTYNHWGSEGWIYSVEDIVMHCNFDSPMYH---NDIALIKTHALFDYDDVTQNITIAPL----ED 158
            |  |.:.. |.|.:||.:.:|     |.|:   |::|:|...:...|   |..||..||    |.
  Fly    87 T--NQYAG-GKIVNVESVAVH-----PDYYNLNNNLAVITLSSELTY---TDRITAIPLVASGEA 140

  Fly   159 L-TDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPE-KCNATYGGTPDLDVGHLCAVGKVGAGA 221
            | .:|..:.:.|:|.|..|.: |::::|:.:. |||| .|...|.   |.|....|...::..|.
  Fly   141 LPAEGSEVIVAGWGRTSDGTN-SYKIRQISLK-VAPEATCLDAYS---DHDEQSFCLAHELKEGT 200

  Fly   222 CHGDTGGPIVDSRGRLVGVGNWGV-PCGYGFPDVFARISFYYSWI 265
            ||||.||..:.. ..|:|:.|:.| .||..:||||.|:|.|..||
  Fly   201 CHGDGGGGAIYG-NTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 77/238 (32%)
Tryp_SPc 45..268 CDD:238113 78/239 (33%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 72/223 (32%)
Tryp_SPc 42..244 CDD:214473 70/221 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.