DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and HPR

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_024306019.1 Gene:HPR / 3250 HGNCID:5156 Length:354 Species:Homo sapiens


Alignment Length:257 Identity:53/257 - (20%)
Similarity:97/257 - (37%) Gaps:45/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQV--VTTTYNHW 106
            ||:||......:.|:...:. ::.|.....::|::||::|.|..|......|...  :..|...:
Human   109 RILGGHLDAKGSFPWQAKMV-SHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLY 172

  Fly   107 GSEGWIYSVEDIVMHCNFDSPMYHN-DIALIKTHALFDYDDVTQNITIAPL----EDLTD-GETL 165
            ..:..:..:|.:|:|     |.||. ||.|||..     ..|..|..:.|:    ::..: |...
Human   173 VGKKQLVEIEKVVLH-----PNYHQVDIGLIKLK-----QKVLVNERVMPICLPSKNYAEVGRVG 227

  Fly   166 TMYGYGSTEIGGDFSW--QLQQLDVTYVAPEKCNATYGGT-------PDLDVG-------HLCAV 214
            .:.|:|.::   :|..  .|:.:.:.......|...|.|:       |...||       |...|
Human   228 YVSGWGQSD---NFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCV 289

  Fly   215 G--KVGAGACHGDTGG-----PIVDSRGRLVGVGNWGVPCGYGFPDVFARISFYYSWIISTI 269
            |  |.....|:||.|.     .:.:......|:.::...|......|:.:::....|:..||
Human   290 GMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 50/251 (20%)
Tryp_SPc 45..268 CDD:238113 50/253 (20%)
HPRXP_024306019.1 Tryp_SPc 110..350 CDD:238113 50/253 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.