DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG33159

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:247 Identity:74/247 - (29%)
Similarity:116/247 - (46%) Gaps:44/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SEKSETANKFSSRIVGGEESDVLAAPYLVSL-QNAYGNHFCAGSIIHDQWVITAASCLAGLRKNN 95
            |..|:|      |||||:|:.:...||||.| ||.|  ..|.||:|..:.|::||.|:.|.:...
  Fly    19 SSSSKT------RIVGGKETTISEVPYLVYLRQNGY--FICGGSLISSRAVLSAAHCVYGSQPEG 75

  Fly    96 VQVVTTTYNHWGS-----EGWIYSVEDIVMH--------CNFDSPMYHNDIALIKTHALFDYDDV 147
            ..|      |.|:     |..:  |.::||.        .|||.     |:||::   |.:...:
  Fly    76 FTV------HAGASRLDQEAPV--VRNVVMFHTSPSYSATNFDM-----DVALLQ---LQEVVVL 124

  Fly   148 TQN--ITIAPLEDLTDGETLT-MYGYGST-EIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDV 208
            |..  .||:|..:..:|.... :.|:|.| |...:.:.|::...|..:...:|..:|.|...|..
  Fly   125 TPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSD 189

  Fly   209 GHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGY-GFPDVFARIS 259
            ..|||..:....:|.||:|||:| .||::.|:.:||..|.. .||.|:..::
  Fly   190 SMLCAAVRGLRDSCSGDSGGPLV-YRGQVCGIVSWGFGCARPSFPGVYTNVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 71/235 (30%)
Tryp_SPc 45..268 CDD:238113 70/234 (30%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 71/235 (30%)
Tryp_SPc 26..251 CDD:238113 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.