DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG31681

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:125/264 - (47%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHD 78
            :||::..|.|.|...|......|       |||||....:...|:.||:|| ...|.|.|.|..|
  Fly     5 LLLSILVSIAGLACAARIPGPEE-------RIVGGSYIPIEYVPWQVSVQN-NSLHCCGGVIYSD 61

  Fly    79 QWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYH-NDIALIKTHALF 142
            :.::|||.||:.:...::.|...: ::|...|.:..|...:.|..:...:|: .|||::...|..
  Fly    62 RAILTAAHCLSNVTVTDLSVRAGS-SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPL 125

  Fly   143 DYDDVTQNITIAPLEDLTD--GETLTMYGYGSTEIGGDFSWQ-LQQLDVTYVAPEKCNATYGGTP 204
            ......:.|   ||.:.|.  |..:...|:|.|.....|.|. ||.:.|..:....|...|... 
  Fly   126 RLGGTVKKI---PLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHV- 186

  Fly   205 DLDVGHLCAVGKVGAGACHGDTGGPIVD-SRG---RLVGVGNWGVPCGYGFPDVFARISFYYSWI 265
            ::.:..:||.|: ....|.||:|||::: ::|   :|:|:.:||..||.. |.|:..|:|:::||
  Fly   187 NITIDMICADGQ-RWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN-PGVYEDIAFFHNWI 249

  Fly   266 ISTI 269
            ..|:
  Fly   250 KYTV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/228 (29%)
Tryp_SPc 45..268 CDD:238113 66/230 (29%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 65/228 (29%)
Tryp_SPc 29..250 CDD:238113 65/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.