DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG31269

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:267 Identity:105/267 - (39%)
Similarity:155/267 - (58%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 STLVLVLLALS--FSEASLRRRAFTSEKSETANKF--SSRIVGGEESDVLAAPYLVSLQNAYGNH 69
            :.::|:||.||  .|..::|.:.     :.|..:|  ..||:||:.::...|||.:|||...|.|
  Fly     3 AVVLLILLGLSGLVSITAIRIKG-----NSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH 62

  Fly    70 FCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIA 134
            .|.|:||::.:|:|||.|:.......:.|||.| |.:...|..|.::.|.:|||:|:|..|||||
  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGT-NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIA 126

  Fly   135 LIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNAT 199
            |::......:|:.||.|.: ||..:..|:.:.:.|:|||.:.|.....||.|.:.||...:|.|.
  Fly   127 LLELVEPIAWDERTQPIPL-PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL 190

  Fly   200 YGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGFPDVFARISFYYSW 264
            .....|.||||:|...::|.||||||:|||:| |.|.|||:.|||.||..|.|||.|.:.||..|
  Fly   191 LSNDEDCDVGHICTFSRLGEGACHGDSGGPLV-SNGYLVGLVNWGWPCATGVPDVHASVYFYRDW 254

  Fly   265 IISTING 271
            |.:.::|
  Fly   255 IRNVMSG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 93/220 (42%)
Tryp_SPc 45..268 CDD:238113 94/222 (42%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 93/220 (42%)
Tryp_SPc 38..258 CDD:238113 94/222 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.