DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG32834

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:236 Identity:77/236 - (32%)
Similarity:119/236 - (50%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWG 107
            |||:||.:.|:..|||...: ...|...|:|:||....:||||||:.......|:|.|::.::.|
  Fly    25 SRIIGGYDVDIEDAPYQAEV-IIDGTAICSGAIITSDTIITAASCVQSYGSIEVRVGTSSRDYDG 88

  Fly   108 SEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGS 172
            : |::..|.:|:.|..::...:.|::||:|........:..|.|:||. ::..||...|:.|:||
  Fly    89 T-GFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQPISIAE-DEPDDGSWCTVSGWGS 151

  Fly   173 TEIGGDFSW----------QLQQLDVTYVAPEKCNATYG---GTPDLDVGHLCAVGKVGAGACHG 224
            |...|  ||          .||...|:....|:|.|..|   |..|..:.:|......|||.|..
  Fly   152 TSWWG--SWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVWFGLWDNGISYLTLCTHNGAGGCSY 214

  Fly   225 DTGGPIVDSRGRLVGVGNWGVPCGYGFPDVFARISFYYSWI 265
            |||.|:|.. |:|||:.:.| .|... |||:|.:.::..||
  Fly   215 DTGAPLVID-GQLVGILSEG-GCTTK-PDVYANVPWFTGWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 74/233 (32%)
Tryp_SPc 45..268 CDD:238113 75/234 (32%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 74/233 (32%)
Tryp_SPc 27..255 CDD:238113 75/234 (32%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.