DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and CG32376

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:249 Identity:62/249 - (24%)
Similarity:108/249 - (43%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQ-WVITAASCLAG-LRKNNVQV 98
            |....|.:|||.|:......||:..||.  |..:|..|.:|.:: |::||..|..| ..|..|:|
  Fly    57 EAQESFPTRIVNGKRIPCTEAPFQGSLH--YEGYFVCGCVIINKIWILTAHHCFFGPPEKYTVRV 119

  Fly    99 VTTTYNHWGSE-----GWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLED 158
                    ||:     |.:..|:.||....::.....:|:|::|..:...:....:.:.:...:.
  Fly   120 --------GSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKT 176

  Fly   159 LTDGETLTMYGYGSTEIGG-DFSWQLQQLDVTYVAPEKCNATYGGT-----PDLDVGHLCAVGKV 217
            ....:...:.|:|.|.... :....|:::.:.|:...||...|...     .|:    :|| .:.
  Fly   177 TKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDM----ICA-SRT 236

  Fly   218 GAGACHGDTGGPIVDSRGRLVGVGNWGVPC-GYGFPDVFARISFYYSWIISTIN 270
            ...:|.||:|||:. |||.|.|:.:||:.| ...:|.|:.....|..||...|:
  Fly   237 NKDSCSGDSGGPLT-SRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKKVIH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 57/234 (24%)
Tryp_SPc 45..268 CDD:238113 58/236 (25%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 57/234 (24%)
Tryp_SPc 66..287 CDD:238113 58/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.