DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Klk12

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:280 Identity:73/280 - (26%)
Similarity:122/280 - (43%) Gaps:69/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHF-CAGS 74
            ::|:|..:..|:|.                 ..:|..|.|....:.|:.|.|  .:|.:. |.|.
  Rat     5 ILLLLCVVGLSQAD-----------------REKIYNGVECVKNSQPWQVGL--FHGKYLRCGGV 50

  Fly    75 IIHDQWVITAASC----LAGLRKNNV-------QVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPM 128
            ::..:||:|||.|    :..|.::::       |:..||::              :.|     |.
  Rat    51 LVDRKWVLTAAHCSGKYMVRLGEHSLSKLDLTEQLRLTTFS--------------ITH-----PS 96

  Fly   129 YH-------NDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGD-FSWQLQQ 185
            ||       :|:.|::.:.........:.:.: |......|....:.|:|:|....| |..:||.
  Rat    97 YHGAYQNHEHDLRLLRLNRPISLTYAVRPVAL-PSSCAPTGAKCHISGWGTTNKPWDPFPDRLQC 160

  Fly   186 LDVTYVAPEKCNATYGG--TPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGV--P 246
            ||::.|:.|.|.|.:.|  |.::    |||.|:.|..||.||:|||:| ..|.|.|:.:||.  |
  Rat   161 LDLSIVSNETCRAVFPGRVTENM----LCAGGEAGKDACQGDSGGPLV-CGGVLQGLVSWGSVGP 220

  Fly   247 CGY-GFPDVFARISFYYSWI 265
            ||. |.|.|:.::..|..||
  Rat   221 CGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 67/245 (27%)
Tryp_SPc 45..268 CDD:238113 69/246 (28%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.