DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Elane

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:285 Identity:83/285 - (29%)
Similarity:119/285 - (41%) Gaps:73/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TLVLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGS 74
            ||..:||||.....:|                :|.||||..:...|.|::||||.. |.|||..:
  Rat    14 TLASMLLALLLVCPAL----------------ASEIVGGRPAQPHAWPFMVSLQRR-GGHFCGAT 61

  Fly    75 IIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSE--GWIYSVEDIVMHCNFDSPMYHNDIALIK 137
            :|...:|::||.|:.|....:||||...::....|  ..|:||:.|..: .||.....|||.:|:
  Rat    62 LIARNFVMSAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFEN-GFDPSRLLNDIVIIQ 125

  Fly   138 THALFDYDDVTQNITIAPL----EDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNA 198
               |.....:..|:.:|.|    :.:.:.......|:|...........||:|:||.|.      
  Rat   126 ---LNGSATINANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVT------ 181

  Fly   199 TYGGTPDLDVGHLC--------AVGKVGAGACHGDTGGPIV--------DS--RGRLVGVGNWGV 245
                       :||        .|.:..||.|.||:|||:|        ||  ||          
  Rat   182 -----------NLCRRRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG---------- 225

  Fly   246 PCGYGF-PDVFARISFYYSWIISTI 269
            .||.|| ||.||.::.:..||.|.|
  Rat   226 GCGSGFYPDAFAPVAEFADWINSII 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 71/245 (29%)
Tryp_SPc 45..268 CDD:238113 73/247 (30%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 71/245 (29%)
Tryp_SPc 33..249 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.