DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Klk9

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:246 Identity:66/246 - (26%)
Similarity:113/246 - (45%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SRIVGGEESDVLAAPYLVSLQNAY-GNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHW 106
            :|.||..|....:.|:...|  .| ....|..::|:|||::|||.|    ||..:.|....::.|
  Rat    21 TRAVGARECQRNSQPWQAGL--FYLTRQLCGATLINDQWLLTAAHC----RKPYLWVRLGEHHLW 79

  Fly   107 GSEG--WIYSVEDIVMHCNFDSPM----YHNDIALIKTHALFDYDDVTQNITIAP-LEDLTDGET 164
            ..||  .:..|.|...|..|:..:    :::||.||:         :.:.:.::| ::.|...::
  Rat    80 QWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIR---------LPRKVRLSPAVQPLNLSQS 135

  Fly   165 L-------TMYGYGSTEIGG-DFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCA-VGKVGAG 220
            |       .:.|:||..... .|...||..:::.:..:.|...|.|  .:....||| :.:.|.|
  Rat   136 LPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCRWAYPG--HISEKMLCAGLWEGGRG 198

  Fly   221 ACHGDTGGPIVDSRGRLVGVGNWG-VPCGY-GFPDVFARISFYYSWIISTI 269
            :|.||:|||:| .:|.|.|:.:.| .||.. ..|.|:..:..|..||.:|:
  Rat   199 SCQGDSGGPLV-CKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWIENTV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 63/239 (26%)
Tryp_SPc 45..268 CDD:238113 64/241 (27%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.