DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss29

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:250 Identity:75/250 - (30%)
Similarity:117/250 - (46%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IVGGEESDVLAAPYLVSLQNAYGN-----HFCAGSIIHDQWVITAASCL-------AGLRKNNVQ 97
            ||||..:.....|:.|||:....|     |.|.|||||.|||:|||.|:       :..|....|
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLGQ 95

  Fly    98 VVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIK-THALFDYDDVTQNITIAPLE-DLT 160
            |    |.:.|.:  :..|..:::|.:|......:|:||:: ..::..:.:| :.:.::|.. ::|
  Rat    96 V----YLYGGEK--LLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNV-KPVKLSPASLEVT 153

  Fly   161 DGETLTMYGYGSTEIGGDF--SWQLQQLDVTYVAPEKCNATYGGTPDLDVGH---------LCAV 214
            ..:...:.|:||..:....  .::|||:.|..|....|...|.....|. .|         ||| 
  Rat   154 KKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLS-NHGQRLILQDMLCA- 216

  Fly   215 GKVGAGACHGDTGGPI---VDSRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWI 265
            |..|..:|:||:|||:   |.....||||.:||..|.. ..|.|:||:.|:..||
  Rat   217 GSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 73/248 (29%)
Tryp_SPc 45..268 CDD:238113 74/249 (30%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.