DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss1

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:273 Identity:87/273 - (31%)
Similarity:131/273 - (47%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQ 79
            ||.|:...|::   ||..|..:       :||||......:.||.|||.:.|  |||.||:|:||
  Rat     4 LLILALVGAAV---AFPLEDDD-------KIVGGYTCPEHSVPYQVSLNSGY--HFCGGSLINDQ 56

  Fly    80 WVITAASCLAG-----LRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTH 139
            ||::||.|...     |.::|:.|:.      |.|.:|.:.: |:.|.|:.|...:|||.|||..
  Rat    57 WVVSAAHCYKSRIQVRLGEHNINVLE------GDEQFINAAK-IIKHPNYSSWTLNNDIMLIKLS 114

  Fly   140 ALFDYDDVTQNITIAPL----EDLTDGETLTMYGYGSTEIGG----DFSWQLQQLDVTYVAPEKC 196
            :     .|..|..:||:    .....|....:.|:|:|...|    |.   ||.:|...::...|
  Rat   115 S-----PVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDL---LQCVDAPVLSQADC 171

  Fly   197 NATYGGTPDLDVGHLCAVG--KVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGFPD---VFA 256
            .|.|.|  ::....:| ||  :.|..:|.||:|||:| ..|:|.|:.:||..|  ..||   |:.
  Rat   172 EAAYPG--EITSSMIC-VGFLEGGKDSCQGDSGGPVV-CNGQLQGIVSWGYGC--ALPDNPGVYT 230

  Fly   257 RISFYYSWIISTI 269
            ::..:..||..||
  Rat   231 KVCNFVGWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 76/238 (32%)
Tryp_SPc 45..268 CDD:238113 78/240 (33%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 76/238 (32%)
Tryp_SPc 24..242 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.