DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Hp

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_036714.2 Gene:Hp / 24464 RGDID:2825 Length:347 Species:Rattus norvegicus


Alignment Length:250 Identity:50/250 - (20%)
Similarity:90/250 - (36%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAG-SIIHDQWVITAASCLAGLRKNNVQV--VTTTYNH 105
            ||:||......:.|:...:.:.:|  ...| ::|.|||::|.|..|......|...  :..|...
  Rat   102 RIIGGSMDAKGSFPWQAKMISRHG--LTTGATLISDQWLLTTAQNLFLNHSENATAKDIAPTLTL 164

  Fly   106 WGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGY 170
            :..:..:..:|.:|:|......    ||.|||........:....|.:...:.:..|....:.|:
  Rat   165 YVGKNQLVEIEKVVLHPERSVV----DIGLIKLKQKVLVTEKVMPICLPSKDYVAPGRMGYVSGW 225

  Fly   171 GSTEIGGDFSWQLQQLDVTYVAPEKCNATY---------------GGTPDLDVGHLCA-VGKVGA 219
            | ..:...|:.:|:.:.:.....|||...|               |..|.|:....|| :.|...
  Rat   226 G-RNVNFRFTERLKYVMLPVADQEKCELHYEKSTVPEKKGAVSPVGVQPILNKHTFCAGLTKYEE 289

  Fly   220 GACHGDTGGPIV-----DSRGRLVGVGNWGVPCGYGFPDVFARISFYYSWIISTI 269
            ..|:||.|....     :......|:.::...|......|:.|.:....|:..|:
  Rat   290 DTCYGDAGSAFAVHDTEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETM 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 48/244 (20%)
Tryp_SPc 45..268 CDD:238113 48/246 (20%)
HpNP_036714.2 CCP 33..87 CDD:153056
Tryp_SPc 102..340 CDD:214473 48/244 (20%)
Tryp_SPc 103..343 CDD:238113 48/246 (20%)
Interaction with CD163. /evidence=ECO:0000250 259..264 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.