DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss38

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:303 Identity:76/303 - (25%)
Similarity:125/303 - (41%) Gaps:57/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYQTGAVSTLVLVLLALSFSE----ASLRRRAFTSEKSETANKFS-----------SRIVGGEE 50
            |:..|..:..|..:|..|..:.    .|:.||   ..||: ||..|           .:::|||.
Mouse     1 MAALTSGLGVLGYLLFPLLLASPTWVTSVSRR---HPKSQ-ANSLSGDVACGQPVLQGKLLGGEF 61

  Fly    51 SDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASC---------------LAGLRKNNVQVVT 100
            :.....|:.|||..: |.|.|.|||:...||::||.|               :..|.|.|     
Mouse    62 ARDRKWPWQVSLHYS-GFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNLEKAN----- 120

  Fly   101 TTYNHWGSEGWIYSVEDIVMHCNFDSPMYH---NDIALIKTHALFDYDDVTQNITIAPLEDLTDG 162
             .:..|      :.:..:::|..|.  |||   .|:||::..:...:.|....|.:.|.:.....
Mouse   121 -RHTQW------FEIYQVIIHPTFQ--MYHPIGGDVALVQLKSAIVFSDFVLPICLPPSDLYLIN 176

  Fly   163 ETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAVG-KVGAGACHGDT 226
            .:....|:|.....|:...:|.:..:..:...:|...||.:..|....|||.. |.....|.||:
Mouse   177 LSCWTTGWGMISPQGETGNELLEAQLPLIPRFQCQLLYGLSSYLLPEMLCAADIKTMKNVCEGDS 241

  Fly   227 GGPIVDSRGRL---VGVGNWGVPCGYG-FPDVFARISFYYSWI 265
            |.|:|..:.:.   :|:.:||..|... :|.|||.:|::.|||
Mouse   242 GSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 61/243 (25%)
Tryp_SPc 45..268 CDD:238113 63/244 (26%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 63/242 (26%)
Tryp_SPc 58..284 CDD:214473 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.