DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Klkb1

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:120/261 - (45%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EKSETANKFSSRIVGGEESDVLAAPYLVSLQ--NAYGNHFCAGSIIHDQWVITAASCLAGLRKNN 95
            :..:...|.::|||||..:.:...|:.||||  .....|.|.||||..|||:|||.|..|:...:
Mouse   379 DSPDCTTKINARIVGGTNASLGEWPWQVSLQVKLVSQTHLCGGSIIGRQWVLTAAHCFDGIPYPD 443

  Fly    96 VQVVTTTYNHWGSEGWIYS------------VEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVT 148
            |         |...|.|.|            ::::::|..:.....:.||||||.....:|.:..
Mouse   444 V---------WRIYGGILSLSEITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQTPLNYTEFQ 499

  Fly   149 QNITIAPLEDLTDGETLTMY------GYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLD 207
            :.|.:.     :..:|.|:|      |:|.|:..|:....||:..:..|..|:|...|   .|..
Mouse   500 KPICLP-----SKADTNTIYTNCWVTGWGYTKEQGETQNILQKATIPLVPNEECQKKY---RDYV 556

  Fly   208 VGH--LCAVGKV-GAGACHGDTGGPIV---DSRGRLVGVGNWGVPCG-YGFPDVFARISFYYSWI 265
            :..  :||..|. |..||.||:|||:|   ..|.:|||:.:||..|. ...|.|:.::|.|..||
Mouse   557 INKQMICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTKVSEYMDWI 621

  Fly   266 I 266
            :
Mouse   622 L 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 75/247 (30%)
Tryp_SPc 45..268 CDD:238113 76/249 (31%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 75/247 (30%)
Tryp_SPc 391..621 CDD:238113 74/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.