DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Klk1b21

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011249110.1 Gene:Klk1b21 / 16616 MGIID:892022 Length:296 Species:Mus musculus


Alignment Length:332 Identity:77/332 - (23%)
Similarity:123/332 - (37%) Gaps:117/332 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSII 76
            :::.||||..|.            :.|....||||||...:..:.|:.|::.. |..:.|.|.::
Mouse     4 LILFLALSLGEI------------DAAPPVQSRIVGGFNCEKNSQPWHVAVFR-YNKYICGGVLL 55

  Fly    77 HDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMH----CNFDSPMYHNDIALIK 137
            :..||:|||.|...        .|:.||.|..:..::..|....|    .:|..|.|  :::|:.
Mouse    56 NPNWVLTAAHCYGN--------ATSQYNVWLGKNKLFQHESSAQHRLVSKSFPHPDY--NMSLMN 110

  Fly   138 THALFDYDDVTQNITIAPLE---DLTD--------------GETLTMYGYGSTEIGGDFSWQLQQ 185
            .|.....||.:.::.:..|.   |:||              |.|....|:||             
Mouse   111 DHTPHPEDDYSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGS------------- 162

  Fly   186 LDVTYVAPEKCN---------------------------ATYGGTP-DLDVGH------------ 210
                 :.|.||.                           ::.|..| ||..|.            
Mouse   163 -----ITPTKCESAPRNIARCRGGAEGPGLGPVHHPLSLSSTGQIPNDLQCGFIKPLPNENCAKA 222

  Fly   211 ---------LCAVGKVGAG--ACHGDTGGPIVDSRGRLVGVGNWG-VPCGY-GFPDVFARISFYY 262
                     ||| |::|.|  .|.||:|||:: ..|.|.|:.:|| :||.. ..|.::.::..:.
Mouse   223 YIHKVTDVMLCA-GEMGGGKDTCAGDSGGPLI-CDGVLQGITSWGSIPCAKPNAPAIYTKLIKFT 285

  Fly   263 SWIISTI 269
            |||..|:
Mouse   286 SWIKDTM 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 67/294 (23%)
Tryp_SPc 45..268 CDD:238113 68/296 (23%)
Klk1b21XP_011249110.1 Tryp_SPc 25..291 CDD:238113 68/296 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.