DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Klk1b11

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_034770.1 Gene:Klk1b11 / 16613 MGIID:892023 Length:261 Species:Mus musculus


Alignment Length:283 Identity:75/283 - (26%)
Similarity:119/283 - (42%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSII 76
            :::.||||....            :.|....||||||...:..:.|:.|::.. |..:.|.|.::
Mouse     4 LILFLALSLGGI------------DAAPPVQSRIVGGFNCEKNSQPWHVAVYR-YNKYICGGVLL 55

  Fly    77 HDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMH----CNFDSPMYH------- 130
            ...||:|||.|           ..:.||.|..:..::..|....|    .:|..|.|:       
Mouse    56 DRNWVLTAAHC-----------HVSQYNVWLGKTKLFQREPSAQHRMVSKSFPHPDYNMSLLIIH 109

  Fly   131 ---------NDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGS-TEIGGDFSWQLQQ 185
                     ||:.|::.....|..|..:.|.: |.|:...|.|..:.|:|| |.........||.
Mouse   110 NPEPEDDESNDLMLLRLSEPADITDAVKPIAL-PTEEPKLGSTCLVSGWGSITPTKFQTPDDLQC 173

  Fly   186 LDVTYVAPEKCNATYGGTPDLDVGHLCAVGKVGAG--ACHGDTGGPIVDSRGRLVGVGNWG-VPC 247
            :.:..:..|.|...: .....|| .||| |::|.|  .|.||:|||:: ..|.|.|:..|| :||
Mouse   174 VSIKLLPNEVCVKNH-NQKVTDV-MLCA-GEMGGGKDTCKGDSGGPLI-CDGVLHGITAWGPIPC 234

  Fly   248 GY-GFPDVFARISFYYSWIISTI 269
            |. ..|.|:.::..:.:||..|:
Mouse   235 GKPNTPGVYTKLIKFTNWIKDTM 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 66/245 (27%)
Tryp_SPc 45..268 CDD:238113 67/247 (27%)
Klk1b11NP_034770.1 Tryp_SPc 24..253 CDD:214473 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.