DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Hp

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_059066.1 Gene:Hp / 15439 MGIID:96211 Length:347 Species:Mus musculus


Alignment Length:261 Identity:57/261 - (21%)
Similarity:96/261 - (36%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAG-SIIHDQWVITAASCLAGLRKN---------NVQV 98
            ||:||......:.|:...:.:.:|  ...| ::|.|||::|.|       ||         :.:.
Mouse   102 RIIGGSMDAKGSFPWQAKMISRHG--LTTGATLISDQWLLTTA-------KNLFLNHSETASAKD 157

  Fly    99 VTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHN--DIALIKTHALFDYDDVTQNITIAPLEDLTD 161
            :|.|...:..:..:..:|.:|:|.|      |:  ||.|||........:....|.:...:.:..
Mouse   158 ITPTLTLYVGKNQLVEIEKVVLHPN------HSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAP 216

  Fly   162 GETLTMYGYGSTEIGGDFSW-------QLQQLD-----VTY---VAPEKCNAT--YGGTPDLDVG 209
            |....:.|:|.   ..:|.:       .|...|     |.|   ..|||.|.|  .|..|.|:..
Mouse   217 GRVGYVSGWGR---NANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEH 278

  Fly   210 HLCA-VGKVGAGACHGDTGGPIV-----DSRGRLVGVGNWGVPCGYGFPDVFARISFYYSWIIST 268
            ..|| :.|.....|:||.|....     :......|:.::...|......|:.|.:....|:..|
Mouse   279 TFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQET 343

  Fly   269 I 269
            :
Mouse   344 M 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 55/255 (22%)
Tryp_SPc 45..268 CDD:238113 55/257 (21%)
HpNP_059066.1 Sushi 33..86 CDD:278512
Tryp_SPc 102..340 CDD:214473 55/255 (22%)
Tryp_SPc 103..343 CDD:238113 55/257 (21%)
Interaction with CD163. /evidence=ECO:0000250 259..264 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831655
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.