DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and PRSS36

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:305 Identity:76/305 - (24%)
Similarity:124/305 - (40%) Gaps:63/305 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLVLLALS-----FSEASLRRRAFTSEKSETAN----KFSSRIVGGEESDVLAAPYLVSLQNAY 66
            |.||:|.:|     |.:::|   :.|.|:.|..:    :.|:|||||..:.....|:.|||.:. 
Human     7 LPLVMLVISPIPGAFQDSAL---SPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHG- 67

  Fly    67 GNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYS------------VEDIV 119
            |.|.|.||:|...||::||.|.  :....::...    .|.....::|            |..||
Human    68 GGHICGGSLIAPSWVLSAAHCF--MTNGTLEPAA----EWSVLLGVHSQDGPLDGAHTRAVAAIV 126

  Fly   120 MHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPL----------EDLTDGETLTMYGYGSTE 174
            :..|:.......|:||::         :....::.|.          .....|......|:|..:
Human   127 VPANYSQVELGADLALLR---------LASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQ 182

  Fly   175 IGG--DFSWQLQQLDVTYVAPEKCNATYG--GTPDLDV----GHLCAVGKVG-AGACHGDTGGPI 230
            ...  ...|.||::::..:....|...|.  |..:|.:    |.|||....| ...|.||:|||:
Human   183 EADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPL 247

  Fly   231 V-DSRGR--LVGVGNWGVPCG-YGFPDVFARISFYYSWIISTING 271
            | :..||  ..|:.::|..|| ...|.||..::.|.:||...:.|
Human   248 VCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWIREQVMG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 62/255 (24%)
Tryp_SPc 45..268 CDD:238113 63/257 (25%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 62/255 (24%)
Tryp_SPc 47..289 CDD:238113 63/257 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316 1/1 (100%)
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.