DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Cfi

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_031712.2 Gene:Cfi / 12630 MGIID:105937 Length:603 Species:Mus musculus


Alignment Length:272 Identity:70/272 - (25%)
Similarity:118/272 - (43%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHF-CAGSIIHDQWVITAASCL 88
            ::|...|..|         |::||:.::|...|:.|::::  |... |.|..|...|::|||.|:
Mouse   350 VKRNTHTRRK---------RVIGGKPANVGDYPWQVAIKD--GQRITCGGIYIGGCWILTAAHCV 403

  Fly    89 AGLRKNNVQVVTTTYNHW---GSEGWIYSVEDIVMHCNFDSPMYHNDIALI--KTHA-------- 140
            ...|.::.||.|...: |   .|:..|.:|:.:::|..::...:.||||||  |.|.        
Mouse   404 RPSRAHSYQVWTALLD-WLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELP 467

  Fly   141 ------------LFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAP 193
                        ||..:|   ...|:......|.:.:....:|..::.|:.| |... |..|...
Mouse   468 NSVPACVPWSPYLFQPND---RCIISGWGRGKDNQKVYSLRWGEVDLIGNCS-QFYP-DRYYEKE 527

  Fly   194 EKCNATYGGTPDLDVGHLCAVGKVGAGACHGDTGGPIV----DSRGRLVGVGNWGVPCGY-GFPD 253
            .:|..|..|:.|               ||.||:|||:|    ::...:.|:.:||..||. .||.
Mouse   528 MQCAGTRDGSID---------------ACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPG 577

  Fly   254 VFARISFYYSWI 265
            |:.|::.|:.||
Mouse   578 VYTRVANYFDWI 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/251 (26%)
Tryp_SPc 45..268 CDD:238113 66/252 (26%)
CfiNP_031712.2 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 232..261 CDD:238060
LDLa 264..298 CDD:294076
Tryp_SPc 360..589 CDD:214473 65/251 (26%)
Tryp_SPc 361..592 CDD:238113 66/252 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.