DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31267 and Prss28

DIOPT Version :9

Sequence 1:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:289 Identity:76/289 - (26%)
Similarity:130/289 - (44%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQ------NAYGNHFC 71
            |:|||||..|:::...:.:..:|:...     ||||:.:.....|:.|||:      |:: .|.|
Mouse     4 LLLLALSCLESTVFMASVSISRSKPVG-----IVGGQCTPPGKWPWQVSLRMYSYEVNSW-VHIC 62

  Fly    72 AGSIIHDQWVITAASCL----AGLRKNNVQVVTTTYNHWGSEGWIY------SVEDIVMHCNFDS 126
            .|||||.||::|||.|:    |......|||         .|.::|      ::..|::|.:::.
Mouse    63 GGSIIHPQWILTAAHCIQSQDADPAVYRVQV---------GEVYLYKEQELLNISRIIIHPDYND 118

  Fly   127 PMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLT------MYGYGS--TEIGGDFSWQL 183
            .....|:||::..||     :..:..::|:....|..|..      :.|:|:  ..:.....:||
Mouse   119 VSKRFDLALMQLTAL-----LVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQL 178

  Fly   184 QQLDVTYVAPEKCNATYGGTPDLDVGH---------LCAVGKVGAGACHGDTGGPIV---DSRGR 236
            .::.:.....:.|...|......:  |         ||| |..|.|.|.||:|||:|   .::..
Mouse   179 HEVKIPIQDNKSCKRAYRKKSSDE--HKAVAIFDDMLCA-GTSGRGPCFGDSGGPLVCWKSNKWI 240

  Fly   237 LVGVGNWGVPCGYGFPDVFARISFYYSWI 265
            .|||.:.|:.|....|.:|:|:....:||
Mouse   241 QVGVVSKGIDCSNNLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 66/256 (26%)
Tryp_SPc 45..268 CDD:238113 68/257 (26%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 68/257 (26%)
Tryp_SPc 31..269 CDD:214473 66/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.